PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000310871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 547aa    MW: 61644.4 Da    PI: 9.1334
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000310871genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601345.6e-422443431100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp ++p+kf  vhk+FGasnv k+l++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l++++a+l  
  MDP0000310871 244 PCAACKFLRRKCTQECVFAPYFPPDNPHKFSKVHKVFGASNVAKILNELSASQRDDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKEVQADLFN 339
                    7********************************************************************************************988 PP

         DUF260  97 lkee 100
                    +k+e
  MDP0000310871 340 AKKE 343
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.748243344IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-41244340IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MPCYCSAEMP WXGPRPYECV RRAWHSDRHQ PMRGSIIQQI FRHWVLFVSM DFLVKVSVFT  60
FCRPXTTCLI RVVNEVHSSV TKKNKEWQKK LPLVVLRAEE IMYSKANSEQ MTRLTRLSGE  120
IRALKPRELL SPCVEVQIVI SLFLRAQESF TIHMVILQSL CFTNFTKLRS TNSSTPNFEE  180
QFLLLYQLTN SYLRXHTWRH VLTQIRTPGH GTRXGHMXTR IDSYTLEVVN FFIKIMSSSS  240
SNSPCAACKF LRRKCTQECV FAPYFPPDNP HKFSKVHKVF GASNVAKILN ELSASQRDDA  300
VNSLAYEAEA RLRDPVYGCV GLISILQQRL KEVQADLFNA KKELATYMGP QGMLSILQPP  360
TYMAQQLQGN ASSAVSPYMS PMIGIPTGAA SGQLMIREPQ QQQIFEAQQL AVAVAAREQQ  420
EMFRSFDQSK QAMQQQAQDH VRFNSGFDSS PGSVTVGGFT QMAGALGNAV SPSLALGFDS  480
GPYHQIQQQQ PHHNPHLHLH LQLQSQLLLQ TQQPQGQHQA QQPQQPQLQA KSDLGEEGGG  540
RSVGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338278.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_008338277.10.0PREDICTED: LOB domain-containing protein 36-like
TrEMBLM5W6J81e-139M5W6J8_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-77ASYMMETRIC LEAVES 2-like 1